Protein coding transcript 59728

• Transcript: Ll_transcript_368788
• CDS coordinates: 110-433 (+)
• Peptide sequence: MAPLSLSLLLSSPSPLPLLHPHRPIFHRTSAAASATDYVSTSTSASTSNLTPKVVVTRERGKNAKLITALAKHEINCLELPLIDHTRGPDFDRLPSVLSGMFLDYTM*
• ORF Type: complete

Annotations of Ll_transcript_368788

• Blastp: Uroporphyrinogen-III synthase, chloroplastic from Arabidopsis with 62.5% of identity
• Blastx: Uroporphyrinogen-III synthase, chloroplastic from Arabidopsis with 67.2% of identity
• Eggnog: Uroporphyrinogen-III Synthase(ENOG4111P6K)
• Kegg: Link to kegg annotations (AT2G26540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417779.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;