Transcript | Ll_transcript_367718 |
---|---|
CDS coordinates | 596-1078 (+) |
Peptide sequence | MVYTHAALCESMRLYPPVPAGRKEASNDDVLPDGTFVKKGTGVVFHTYTMGRSEKIWGPDWAEFRPERWLNRVQEDDKWKFKGVDPFTYPVFLAGPRVCLGKEMAFLQMKTMVAGIMRQFKVVPVVANGAEPEYTSALTSLVKGGLHVRIEARSVTKTHY* |
ORF Type | complete |
Blastp | Cytochrome P450 94A2 from Vicia with 70.13% of identity |
---|---|
Blastx | Cytochrome P450 94A2 from Vicia with 63.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAG33645) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428624.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer