Protein coding transcript 59788

• Transcript: Ll_transcript_368699
• CDS coordinates: 1361-1912 (+)
• Peptide sequence: MSLQYFLYQLLRGLKYIHSANVLHRDLKPSNLLLNANCDLKVCDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIIRRKPLFPGKDYVQQLALITELLGSPDDSDLGFLRSDNAKKYVKQLPHVEKQPFAQRFPDMSPLAIDLAEKMLVFNPSKRMTGMPLYLV*
• ORF Type: complete

Annotations of Ll_transcript_368699

• Blastp: Mitogen-activated protein kinase homolog NTF6 from Nicotiana with 84.39% of identity
• Blastx: Mitogen-activated protein kinase 13 from Arabidopsis with 83.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448687.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;