Protein coding transcript 598

• Transcript: Ll_transcript_462538
• CDS coordinates: 2-355 (+)
• Peptide sequence: EASYVNIPVIAFCNTDSPLRFVDIAIPCNTKSHHSIGLMWWLLAREVLRLRGLISREGKWDVVVDLFFYRDPEEAEKEEQAAKEVAVAPIKAEPEYAPITQPEWMPEAVAPEGQSWDE
• ORF Type: internal

Annotations of Ll_transcript_462538

• Blastp: 40S ribosomal protein SA from Bombyx with 70.34% of identity
• Blastx: 40S ribosomal protein SA from Maconellicoccus with 93.06% of identity
• Eggnog: 30S ribosomal protein S2(COG0052)
• Kegg: Link to kegg annotations (692424)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419662.1)
• Pfam: Ribosomal protein S2 (PF00318.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;