Protein coding transcript 5984

• Transcript: Ll_transcript_334045
• CDS coordinates: 194-1012 (+)
• Peptide sequence: MNSNESPKDPIPLDNRPGIFIIGSPNVGKRTLLSRLLSIDLEDASDSASEVNVHGWNISTKYYTADVSVWTANLHDDFSVRSLPIFQQLDALVMVFDMNDLSSLTALQNWVSCIDIQNFEILLCIGNKVDLIPGHPVHAEYRRRSMKLEDSAVDPYSEFAKYGISESEGTSLLGDEEPSGDIRRSCLEWCTENNIEFIEACASNADFDKCLSVDGDLQGIERLYGALSAHMWPGMILKSGDRISEPSLPEKEGRFLPSVFHSMVHSAISSFE*
• ORF Type: complete

Annotations of Ll_transcript_334045

• Blastp: Ras-related protein Rab-12 from Rattus with 22.73% of identity
• Blastx: -
• Eggnog: member RAS oncogene family(ENOG410XPUI)
• Kegg: Link to kegg annotations (25530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445153.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;