Protein coding transcript 59853

• Transcript: Ll_transcript_368127
• CDS coordinates: 3-794 (+)
• Peptide sequence: INRHASSIAFPIPWLEFRSRVSLLPSFTDSNMNVKSTHSSYRDRTHEFESIAERLKKSRSAPNSTNSTITTSSSSRSDEHRSAIAIQSEFNKRASKIGYGIHQTSQKLAKLAKLAKRTSVFDDPTMEIQELTGVIKQDINALNSAVLDLQSLSNSRNQSGDFSADTTTHSTTVVDDLKTRLMSTTKEFKDVLTMRTENLKVHENRRQLFSSSASKESANPFVRQRPLATRTSASSSNAQAPPWANASGSPSSSQLFPKLDWLN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_368127

• Blastp: Syntaxin-32 from Arabidopsis with 62.45% of identity
• Blastx: Syntaxin-32 from Arabidopsis with 62.45% of identity
• Eggnog: Syntaxin 5(ENOG410Y2MB)
• Kegg: Link to kegg annotations (AT3G24350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415743.1)
• Pfam: Syntaxin-5 N-terminal, Sly1p-binding domain (PF11416.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;