Protein coding transcript 599

• Transcript: Ll_transcript_462548
• CDS coordinates: 2-802 (+)
• Peptide sequence: INPGSRFGYGSAAQFFIGSFDGNVFKSEGEYSWLDWGADNYATITFDNAPNGEIISIGWMSNWHYTQATPGGTWRNTFTVPRLLQLVTIDGKVRLVQNPVKNIDDLRIVDDVVHMSQVAVTNEHIFSEPTVNGGRVMDMVIEFDAGSAVEFGVKVYYGKNQETLIGYDTAKGQVYIDRGLSGTVNFNDVFPQRHGADVALRNNKLKLRILVDHTSVEVFANQGEVAITDVIFPDPFKDGISFYSVNGTATVDSVDMYPMKATHGML*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_462548

• Blastp: Levanase from Bacillus with 36.5% of identity
• Blastx: Levanase from Bacillus with 36.5% of identity
• Eggnog: Hydrolase(COG1621)
• Kegg: Link to kegg annotations (BSU27030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013457629.1)
• Pfam: Glycosyl hydrolases family 32 N-terminal domain (PF00251.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;