Transcript | Ll_transcript_367849 |
---|---|
CDS coordinates | 17-1042 (+) |
Peptide sequence | MDPPHRAIPKIRQVGFFTPGAPPDPSHSGPTDPTLVPSSSPVFIHLSDNLLLHSRHLPTPQSYTAADFLTSPLSSVPLPSPSSASYSSIMAAEGKGGGGKVASSYPRGGFDLSTAMKKSGGSEKEKSNKGGGSAEMKDQLKQQKPKTSRAERRALQEAQRAAKAEGNKAYGDATSANAKPAKPAKPAQKVDNSASVASEKKAGDPPEKDRKKDVPQPRMQYDDKNRVEKARRRAVVKQTEARNRVELFRHLPQYEHGSQLPDLEAKFFHLDSVHPAVYKVGLQYLLGDISCGNDRCIAMLEAFQEAIKDYRVPPEKTLVRDLTAKISSYVSFLIECRPLSIS |
ORF Type | 3prime_partial |
Blastp | Translation initiation factor eIF-2B subunit delta from Rattus with 36.24% of identity |
---|---|
Blastx | Translation initiation factor eIF-2B subunit delta from Mus with 47.06% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (117019) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428174.1) |
Pfam | Initiation factor 2 subunit family (PF01008.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer