Transcript | Ll_transcript_370003 |
---|---|
CDS coordinates | 144-623 (+) |
Peptide sequence | MAEQTEQAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIDGTYIDKKCPFTGNVSIRGRILSGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPISKTVRFNVLKVIPAGSSGGAKKAFTGI* |
ORF Type | complete |
Blastp | 40S ribosomal protein S11 from Euphorbia sect. Esula with 94.97% of identity |
---|---|
Blastx | 40S ribosomal protein S11 from Euphorbia sect. Esula with 94.97% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441103.1) |
Pfam | Ribosomal_S17 N-terminal (PF16205.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer