Protein coding transcript 59956

• Transcript: Ll_transcript_369987
• CDS coordinates: 856-1230 (+)
• Peptide sequence: MNRTIIVRRNYLHFIKKYQRYFQLYILSLIVVLFVSRKLSSIFNMFKVREEAFKYPCSCITLLPCEGRRSCYYWSMQTNLEDSEVQCAESDPSWIFWWCKEGFYWNLNFDIQFLLQNSDAVMPF*
• ORF Type: complete

Annotations of Ll_transcript_369987

• Blastp: 40S ribosomal protein S11 from Soja with 100% of identity
• Blastx: 40S ribosomal protein S11 from Euphorbia sect. Esula with 95% of identity
• Eggnog: One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal(COG0186)
• Kegg: Link to kegg annotations (547984)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441103.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;