Protein coding transcript 59959

• Transcript: Ll_transcript_369996
• CDS coordinates: 158-637 (+)
• Peptide sequence: MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKSIGLGFKTPREAIDGTYIDKKCPFTGNVSIRGRILSGTVHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHVSPCFRVKEGDHVIIGQCRPISKTVRFNVLKVIPAGSSGGAKKAFTGI*
• ORF Type: complete

Annotations of Ll_transcript_369996

• Blastp: 40S ribosomal protein S11 from Euphorbia sect. Esula with 94.97% of identity
• Blastx: 40S ribosomal protein S11 from Euphorbia sect. Esula with 94.97% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441103.1)
• Pfam: Ribosomal_S17 N-terminal (PF16205.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;