Protein coding transcript 59976

• Transcript: Ll_transcript_367442
• CDS coordinates: 142-834 (+)
• Peptide sequence: MFYKDGDNPSTTLIIPSSSSSFKENNTNTMNMVMPINPLLSRSSSFNTTNDFNTNNNTRRRATSADSLSSFSTSTLPNSSFQTHLSSNTFGFNILTYLRVGYKWITRFLALSCYAVMIIPGFFQVGYCYFFSSQIRRGIVFGDKPRNKLDLYLPKSNDGPKPVVAFVTGGAWTIGNKAWGSLLGQQLSERDIIVACIDYGNFPQNLPNGAISWGTYCCMCTCGEGNEGGW*
• ORF Type: complete

Annotations of Ll_transcript_367442

• Blastp: Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 from Arabidopsis with 52.63% of identity
• Blastx: Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 from Arabidopsis with 77.98% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT1G26120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423337.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;