Protein coding transcript 59985

• Transcript: Ll_transcript_367436
• CDS coordinates: 1154-1885 (+)
• Peptide sequence: MLSDISSCRNFPQVTISDMVADASRGISFVCNNIAEYGGDPNRIYLMGQSAGAHIAACALVEKAMKEAGEGESSSWSLSQIKAYFGLSGGYNLYKLIDHFHSRGLYRAIFLSMMEGEESLHRFSPEVMVQVPNFANAASLLPPVVLFHGTGDYSIPSDSSKSFSETLKKVGVRAETILYEGKTHTDVFVQDPMRGGKDDLFDDLVAYIHAGDAEASAKDAAAPPRRRLVPEFMLKLAHIVSPF*
• ORF Type: complete

Annotations of Ll_transcript_367436

• Blastp: Isoprenylcysteine alpha-carbonyl methylesterase ICME from Arabidopsis with 71.06% of identity
• Blastx: Isoprenylcysteine alpha-carbonyl methylesterase ICME from Arabidopsis with 69.83% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT5G15860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423337.1)
• Pfam: alpha/beta hydrolase fold (PF07859.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;