Protein coding transcript 60014

• Transcript: Ll_transcript_369327
• CDS coordinates: 80-811 (+)
• Peptide sequence: MCHSLFLSHSFPSFTLLPTKSFKHSPPNTNHFPSTFSSSLSKPPHTFSPSLKNLSASRTQTLGYTRHGGCFGAMKNWVLLQIFRWEMTTESVVEEQSEGNDFTINDHEDREMATRWATTFLFGQTLSVVSPEMAYASNTVKMNEIYEVGELFDLGIQLLYLLLLLGLLGAGTYSVIRQVLVRRELDLSAKELQEQIRSGAADATGLFELGAVMLRRKFYPAATKYLLQAIEKWDGDDQDLAQV*
• ORF Type: complete

Annotations of Ll_transcript_369327

• Blastp: Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic from Arabidopsis with 75.78% of identity
• Blastx: Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic from Arabidopsis with 75.19% of identity
• Eggnog: Photosystem I assembly related protein(ENOG4111J4M)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414106.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;