Transcript | Ll_transcript_369332 |
---|---|
CDS coordinates | 2336-2824 (+) |
Peptide sequence | MELFFYDDFFHYHFPWLSQEQVRSGDADATGLFELGAVMLRRKFYPAATKYLLQAIDKWDGDDQDLAQVYNALGVSYVRDDKLEKGITQFETAVKLQPGYVTAWNNLGDAYEKKKEYKAALMAFEEVLLFDPDNKIAQPRRDAMKEQVEMYKGVPLKSKEKR* |
ORF Type | complete |
Blastp | Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic from Arabidopsis with 81.25% of identity |
---|---|
Blastx | Tetratricopeptide repeat domain-containing protein PYG7, chloroplastic from Arabidopsis with 81.25% of identity |
Eggnog | Photosystem I assembly related protein(ENOG4111J4M) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414109.1) |
Pfam | Tetratricopeptide repeat (PF13181.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer