Protein coding transcript 6005

• Transcript: Ll_transcript_333772
• CDS coordinates: 79-747 (+)
• Peptide sequence: MVPEVTWAQRSSATEAEKNHVFLAIMVPDVSPETIKLDVQPGYLDFTGYSESKKANYHVKLELYKEIDPSASKTHHTSRSVEFVLQKKDLEVEFWPRLLKDAKKVHFLKTDFDKWVDEDEQDEVGEDDDYMSKMGGMQGMGGEGGMGGMGGMGGEGGFGGIDFSKLGGMGGAGMPDMSSMMGGMGGMGDDGDDDDDDDEMPELEDEEAKGGAADKPKIEEVA*
• ORF Type: complete

Annotations of Ll_transcript_333772

• Blastp: Protein wos2 from Schizosaccharomyces with 40.22% of identity
• Blastx: Protein wos2 from Schizosaccharomyces with 40.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC9E9.13)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007163102.1)
• Pfam: CS domain (PF04969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;