Protein coding transcript 60075

• Transcript: Ll_transcript_370211
• CDS coordinates: 1818-2552 (+)
• Peptide sequence: MTGNCRFYGIEDNHLQLDAQLLIGGKKKTPGKRITSLQFSPNDPSKLLVASADSHVCILSGVDIIYKFKGLRSAGQMHASFTSDGKHIVSVSEDSNVCIWNYTGQDRSTSKAKKIWSSESFLSDKAAIAIPWCGIESKPGTLLSPSLKHDFSQRLTPSSHDRSFLNRGFLSELVPKASPTWPAETLEGSSRSFVTPTMCKSEYKFLRNACKGMSNSNLWGQVIVTAGWDGHIRVYQNYGLPVRD*
• ORF Type: complete

Annotations of Ll_transcript_370211

• Blastp: Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 30.43% of identity
• Blastx: WD repeat-containing protein 44 from Bos with 31.11% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC3H5.08c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422019.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;