Protein coding transcript 60078

• Transcript: Ll_transcript_370214
• CDS coordinates: 1895-2629 (+)
• Peptide sequence: MTGNCRFYGIEDNHLQLDAQLLIGGKKKTPGKRITSLQFSPNDPSKLLVASADSHVCILSGVDIIYKFKGLRSAGQMHASFTSDGKHIVSVSEDSNVCIWNYTGQDRSTSKAKKIWSSESFLSDKAAIAIPWCGIESKPGTLLSPSLKHDFSQRLTPSSHDRSFLNRGFLSELVPKASPTWPAETLEGSSRSFVTPTMCKSEYKFLRNACKGMSNSNLWGQVIVTAGWDGHIRVYQNYGLPVRD*
• ORF Type: complete

Annotations of Ll_transcript_370214

• Blastp: Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 30.43% of identity
• Blastx: Uncharacterized WD repeat-containing protein C3H5.08c from Schizosaccharomyces with 29.51% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC3H5.08c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422019.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;