Transcript | Ll_transcript_367358 |
---|---|
CDS coordinates | 1-432 (+) |
Peptide sequence | RKALNSITVKYRNGFVQAFHRDLKDNNTFYIYSDLTNYSIGASGDEVWNDQDILGNKSVIWYREPLNPVSGEKIGKAIQIAPEDSINIAGISQVSDGVASWHVAVSKFTDSPLLSAALPVRDATNKSIVAVVGVTTAFYSVGRL |
ORF Type | internal |
Blastp | Histidine kinase 1 from Arabidopsis with 68.49% of identity |
---|---|
Blastx | Histidine kinase 1 from Arabidopsis with 68.49% of identity |
Eggnog | Histidine kinase(ENOG410XT1K) |
Kegg | Link to kegg annotations (AT2G17820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446887.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer