Protein coding transcript 60122

• Transcript: Ll_transcript_369601
• CDS coordinates: 1240-1584 (+)
• Peptide sequence: MPQIYSSSRQYTTEEYADALIQEYTQQLQTLYNYGARKMVLFGVGQIGCSPNELAQNSPDGSTCVERINTANQIFNNKLKSLVDQLNNQLPDARFIYINSYAIFQDIISNPTAYG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_369601

• Blastp: GDSL esterase/lipase At1g29660 from Arabidopsis with 68.89% of identity
• Blastx: GDSL esterase/lipase At1g29670 from Arabidopsis with 70.83% of identity
• Eggnog: GDSL-motif lipase hydrolase family protein(ENOG410YD3P)
• Kegg: Link to kegg annotations (AT1G29660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444688.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;