| Transcript | Ll_transcript_369419 |
|---|---|
| CDS coordinates | 250-840 (+) |
| Peptide sequence | MEQPTPKPDHKPNATDSSHAPNGDSNNTEALEKVSPGSDSQPSSEILTERAASTRNMKKSVHWSPDLVTEPTFDSSPKESPSNPEIHSSLSYSDSSLSYSDSSSPYSDSSSPSSDSSSPSSDSSSSVTEKVDVVKNVLGRWGRKLGEATRKAETLAGNTWQHCKFFYLFKSFSHRSTLYHDNLMNLLWQLGRYKKI* |
| ORF Type | complete |
| Blastp | Putative GEM-like protein 3 from Arabidopsis with 39.05% of identity |
|---|---|
| Blastx | GLABRA2 expression modulator from Arabidopsis with 71.74% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT4G40100) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019420162.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer