Protein coding transcript 60257

• Transcript: Ll_transcript_367588
• CDS coordinates: 2495-3202 (+)
• Peptide sequence: MSTLDATRAELALLVLYLNKAESRDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVFRLFKFVNDLHGLISPTAQGTPLPLIFLGKSKNALLSTFLFLDQFVWLGRSGIYQNKERTELIGRISLFCWMGSSVCSTLVELGELGRLSASMKKIEKELKNSNKYDNEQYNAKLKISNERTLSLIKAGMDIVVAVGLLQLAPKKVTPRLTGAFGFVTSLISCYQLLPAQAKSKTS*
• ORF Type: complete

Annotations of Ll_transcript_367588

• Blastp: Peroxisomal membrane protein 11D from Arabidopsis with 81.97% of identity
• Blastx: Peroxisomal membrane protein 11D from Arabidopsis with 81.97% of identity
• Eggnog: peroxisomal biogenesis factor 11(ENOG4111NS6)
• Kegg: Link to kegg annotations (AT2G45740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433953.1)
• Pfam: Peroxisomal biogenesis factor 11 (PEX11) (PF05648.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;