Transcript | Ll_transcript_367596 |
---|---|
CDS coordinates | 172-879 (+) |
Peptide sequence | MSTLDATRAELALLVLYLNKAESRDKICRAIQYGSKFLSDGQPGTAQNVDKSTSLARKVFRLFKFVNDLHGLISPTAQGTPLPLIFLGKSKNALLSTFLFLDQFVWLGRSGIYQNKERTELIGRISLFCWMGSSVCSTLVELGELGRLSASMKKIEKELKNSNKYDNEQYNAKLKISNERTLSLIKAGMDIVVAVGLLQLAPKKVTPRLTGAFGFVTSLISCYQLLPAQAKSKTS* |
ORF Type | complete |
Blastp | Peroxisomal membrane protein 11D from Arabidopsis with 81.97% of identity |
---|---|
Blastx | Peroxisomal membrane protein 11D from Arabidopsis with 81.97% of identity |
Eggnog | peroxisomal biogenesis factor 11(ENOG4111NS6) |
Kegg | Link to kegg annotations (AT2G45740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433953.1) |
Pfam | Peroxisomal biogenesis factor 11 (PEX11) (PF05648.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer