Protein coding transcript 60308

• Transcript: Ll_transcript_368907
• CDS coordinates: 902-1546 (+)
• Peptide sequence: MFLVAYSIIFGIKTAKGFRWLLNRLNLSSGNGKFKIKSKLDSCSCQFKVTVFFLVVLVILWGVSGALVKAEFKHGGSAAQLWFACLVSPIGVWIRWFLARLNGRGLGKAGLFKWIPFGTLIANVSAASVMAALASLKEAVNTRDCDTVVAGIQFGLMGCLSTVSTFASEFNAMSESNQPWRADAYAIITICVSFSLGILIYGVPVWTRGFDIEA*
• ORF Type: complete

Annotations of Ll_transcript_368907

• Blastp: Fluoride export protein 2 from Schizosaccharomyces with 33.08% of identity
• Blastx: Fluoride export protein 2 from Schizosaccharomyces with 33.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC977.11)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414963.1)
• Pfam: CrcB-like protein, Camphor Resistance (CrcB) (PF02537.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;