Transcript | Ll_transcript_368907 |
---|---|
CDS coordinates | 902-1546 (+) |
Peptide sequence | MFLVAYSIIFGIKTAKGFRWLLNRLNLSSGNGKFKIKSKLDSCSCQFKVTVFFLVVLVILWGVSGALVKAEFKHGGSAAQLWFACLVSPIGVWIRWFLARLNGRGLGKAGLFKWIPFGTLIANVSAASVMAALASLKEAVNTRDCDTVVAGIQFGLMGCLSTVSTFASEFNAMSESNQPWRADAYAIITICVSFSLGILIYGVPVWTRGFDIEA* |
ORF Type | complete |
Blastp | Fluoride export protein 2 from Schizosaccharomyces with 33.08% of identity |
---|---|
Blastx | Fluoride export protein 2 from Schizosaccharomyces with 33.08% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC977.11) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414963.1) |
Pfam | CrcB-like protein, Camphor Resistance (CrcB) (PF02537.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer