Protein coding transcript 60381

• Transcript: Ll_transcript_367777
• CDS coordinates: 1085-1663 (+)
• Peptide sequence: MGFAFISNSYVHQLSSINSQNAHIAVFSCKNMTLRNITLTAPRDSPNTDGIKLSKSQGINIKNVHIGTGDDCIAIISGTKNVNISNVYCGPGHGISVGSLGKHDDEVDVRDIHVKNCTFNGTSDGLRIKTWATPLNQPIKASNFLYEDILVIDVENPINIDQHYCPSGNCMDKVPSRVQISNIHYKNIQGSVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_367777

• Blastp: Exopolygalacturonase from Platanus with 47.09% of identity
• Blastx: Exopolygalacturonase from Platanus with 47.09% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434660.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;