Protein coding transcript 60382

• Transcript: Ll_transcript_367778
• CDS coordinates: 1089-1838 (+)
• Peptide sequence: MGFAFISNSYVHQLSSINSQNAHIAVFSCKNMTLRNITLTAPRDSPNTDGIKLSKSQGINIKNVHIGTGDDCIAIISGTKNVNISNVYCGPGHGISVGSLGKHDDEVDVRDIHVKNCTFNGTSDGLRIKTWASPLNHTLKASNFVYEDIVIIDVEHPINIDQEYCPSGNCGNKVPSKVQISNVHYKNIRGSCKGDIAVNFKCSKSNPCQNITGIDVNLWSSLGRTGTLTNYCSHVHGAFYGKQLPPSCI*
• ORF Type: complete

Annotations of Ll_transcript_367778

• Blastp: Exopolygalacturonase from Platanus with 44.86% of identity
• Blastx: Exopolygalacturonase from Platanus with 44.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434660.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;