Transcript | Ll_transcript_367789 |
---|---|
CDS coordinates | 1530-2279 (+) |
Peptide sequence | MGFAFISNSYVHQLSSINSQNAHIAVFSCKNMTLRNITLTAPRDSPNTDGIKLSKSQGINIKNVHIGTGDDCIAIISGTKNVNISNVYCGPGHGISVGSLGKHDDEVDVRDIHVKNCTFNGTSDGLRIKTWASPLNHTLKASNFVYEDIVIIDVEHPINIDQEYCPSGNCGNKVPSKVQISNVHYKNIRGSCKGDIAVNFKCSKSNPCQNITGIDVNLWSSLGRTGTLTNYCSHVHGAFYGKQLPPSCI* |
ORF Type | complete |
Blastp | Exopolygalacturonase from Platanus with 44.86% of identity |
---|---|
Blastx | Exopolygalacturonase from Platanus with 44.86% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434660.1) |
Pfam | Glycosyl hydrolases family 28 (PF00295.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer