Transcript | Ll_transcript_370241 |
---|---|
CDS coordinates | 674-2017 (+) |
Peptide sequence | MGDEISEAMNLDLNLGPGPEPLVGSAVDEAMNLDDWVEEPFHSFNEAVRLRSRQRWRWRRHHLPRPPVPPPLPPAFHVHIPEVPPHLHFHIPPAARNISMELNNYLVNSGHGSPLQAGEGSVAVEERIEVEMPKACEHNNGVMEDETAEKKDVVDMGSGNDGDFFDCNICLDLAKDPVVTCCGHLFCWPCLYRWVQLHSDAKECPVCKGEVILKNVTPIYGRGNNVRVPEEDVTLKIPLRPHARRIESLRQTLQRNPFAYPFDEMIRHLGSRVDRTRDLVQSNNPDNAREMAERTSSLLSRFLTSRGIRREQNVGAPPDDAVGLTQNNPPEAAGDSRRTHSRSLRRTQSYRARFASALSSSAEGIVDAYFSIQPFGRNQEQPPPVDDRDSFSSIGAVINSESQVDSAVEIDSMVSLSTSSSRRRNDASRVSDVDSGDSRAPRRRRLN* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase RMA3 from Arabidopsis with 47.31% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase RMA3 from Arabidopsis with 47.31% of identity |
Eggnog | Ring finger protein(ENOG4111IHV) |
Kegg | Link to kegg annotations (AT4G27470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421249.1) |
Pfam | Ring finger domain (PF13639.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer