Protein coding transcript 6045

• Transcript: Ll_transcript_333968
• CDS coordinates: 324-1247 (+)
• Peptide sequence: MGHVEYIAYVLAMVTVSIILIVLGVVLILVCKKKPIESKEIIPVKLYARAYPLTSIDAATDGFNQRRIVGQGRLGTVYAGSLEKQELVAVKRIHPFHVLSNAGSGFGFGFSSVLKWLSLAQHPNIVPIIGFSEAPAERVILMEFVHLESLNFYMQDGASRLDWNKRLRIASGAARGLQYLHEVVAPSIVHGCVKSSNILIDVNFCARVSDYGLNFLAPMEKRGLVGYVDDEYWNVKGGGGATKESDVYGLGVVLLELLSGRECEGGLLVKWALPLIKEMSFSELLDPRLVIPSDMRPLVRLAKVASTC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_333968

• Blastp: Serine/threonine-protein kinase-like protein ACR4 from Arabidopsis with 38.13% of identity
• Blastx: Serine/threonine-protein kinase-like protein ACR4 from Arabidopsis with 38.13% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G59420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425180.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;