Transcript | Ll_transcript_369013 |
---|---|
CDS coordinates | 84-611 (+) |
Peptide sequence | MEPLLRGENSGRRDRPRGLHRRSDALTYGSNYEKAAALVDLAEDGVGLPEQILDSSSFQTYAKFYFIFTKFDLIWSLSYFALIVLNFLEKPLWCENNTTHSCKDREYFFLGELPYLTAVECIIYEGIILFLITIHTFFPISYEGSHIYWKNTTSQLKVCCFGFVQINIIYDSIDF* |
ORF Type | complete |
Blastp | Two pore calcium channel protein 1 from Arabidopsis with 56.9% of identity |
---|---|
Blastx | Two pore calcium channel protein 1 from Arabidopsis with 59.73% of identity |
Eggnog | Two pore segment channel 1(ENOG410XZT8) |
Kegg | Link to kegg annotations (AT4G03560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437005.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer