Protein coding transcript 60454

• Transcript: Ll_transcript_369013
• CDS coordinates: 84-611 (+)
• Peptide sequence: MEPLLRGENSGRRDRPRGLHRRSDALTYGSNYEKAAALVDLAEDGVGLPEQILDSSSFQTYAKFYFIFTKFDLIWSLSYFALIVLNFLEKPLWCENNTTHSCKDREYFFLGELPYLTAVECIIYEGIILFLITIHTFFPISYEGSHIYWKNTTSQLKVCCFGFVQINIIYDSIDF*
• ORF Type: complete

Annotations of Ll_transcript_369013

• Blastp: Two pore calcium channel protein 1 from Arabidopsis with 56.9% of identity
• Blastx: Two pore calcium channel protein 1 from Arabidopsis with 59.73% of identity
• Eggnog: Two pore segment channel 1(ENOG410XZT8)
• Kegg: Link to kegg annotations (AT4G03560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437005.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;