Protein coding transcript 605

• Transcript: Ll_transcript_367373
• CDS coordinates: 42-404 (+)
• Peptide sequence: MSKAFVYRMFLIMVLVQSIYGHQVHRVGDEQGWNPNVDYKAWLAGKTFHLGDVLEFNYKEGLEVQEVTANNFEACNNGNVIFEDHTGKTFIPLRCTGSHYFTCGVYNYCKEGMKLNITVT*
• ORF Type: complete

Annotations of Ll_transcript_367373

• Blastp: Blue copper protein from Pisum with 42.02% of identity
• Blastx: Blue copper protein from Pisum with 42.02% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015934822.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;