Transcript | Ll_transcript_367373 |
---|---|
CDS coordinates | 42-404 (+) |
Peptide sequence | MSKAFVYRMFLIMVLVQSIYGHQVHRVGDEQGWNPNVDYKAWLAGKTFHLGDVLEFNYKEGLEVQEVTANNFEACNNGNVIFEDHTGKTFIPLRCTGSHYFTCGVYNYCKEGMKLNITVT* |
ORF Type | complete |
Blastp | Blue copper protein from Pisum with 42.02% of identity |
---|---|
Blastx | Blue copper protein from Pisum with 42.02% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015934822.1) |
Pfam | Plastocyanin-like domain (PF02298.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer