Protein coding transcript 60583

• Transcript: Ll_transcript_420419
• CDS coordinates: 337-1497 (+)
• Peptide sequence: MFFSRHLTDTTSAAASATSFRFPSSASSDVDIAPPGVPSRIPSSTSHLFSQPSSWFSSPSLDLKRSSSQALYHPTILGIQNTIGQNEAWYSTSPLAKRPRYESGSNLPIYPQRPGEKDCAHYMLTRTCKFGESCKFDHPIWVPEGGIPDWKEVPDVVTNETLPERPEEPDCPYFVKTQRCKFGPRCKFNHPTVSSESAGVSGLPERPSEPPCAFYVKTGRCKFGATCKFHHPKDIQIQLLDDLSHTVQQTQTSFMMEGAMVDTQTIKPLMPPLFQNSKGLPVRLAEVDCPFYMKTGSCKYGASCRYNHPDRTVGPSVLASSAAYLNIGARNPATTVYQAFDPRLSNPMSQVGMAETIYPQRPGQIECDVSTCLKFQSYYTCLECEQ*
• ORF Type: complete

Annotations of Ll_transcript_420419

• Blastp: Zinc finger CCCH domain-containing protein 37 from Arabidopsis with 53.97% of identity
• Blastx: Zinc finger CCCH domain-containing protein 37 from Arabidopsis with 59.87% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410YAW6)
• Kegg: Link to kegg annotations (AT3G12680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449303.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;