Protein coding transcript 60677

• Transcript: Ll_transcript_419176
• CDS coordinates: 1410-1862 (+)
• Peptide sequence: MRYSIDTMQSVCLDDFGGEKVVPPNLQETTLIQHIFGGCLQSEVICTKCDQKSSQYENIMDLTVEIHGDATSLEKCLDQFTAKEWLHGENMYKCDGCKDYVKAWKRLTVKRAPNILTIAFKRFQSGRFGKLNKRVAFPEILNLSPYKSETG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_419176

• Blastp: Ubiquitin carboxyl-terminal hydrolase 18 from Arabidopsis with 74.83% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 18 from Arabidopsis with 75.67% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ92)
• Kegg: Link to kegg annotations (AT4G31670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448008.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF13423.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;