| Transcript | Ll_transcript_367371 |
|---|---|
| CDS coordinates | 1-315 (+) |
| Peptide sequence | KKLSTSKLENHAINHVYGSFTIHENNGIVRIEITSGSAEERFTLSKLLQLLLEEKLEVLNCLSTEVNGRLLHSVQCEVNKSKSVDLSELRRKVADVFPSYACCE* |
| ORF Type | 5prime_partial |
| Blastp | Transcription factor bHLH126 from Arabidopsis with 38.71% of identity |
|---|---|
| Blastx | - |
| Eggnog | Transcription factor(ENOG41114KF) |
| Kegg | Link to kegg annotations (AT4G25410) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019465265.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer