Protein coding transcript 60810

• Transcript: Ll_transcript_419158
• CDS coordinates: 320-814 (+)
• Peptide sequence: MSLETNLLAKAKRHAAFRLCDVSNYTSEILEIQADAPSLHVLFVPGNPGVIFFYKDFVEYLYELLGGTASVTAIGHVSQTKKNWEHGRLFSLHEQIDHKIDFIREELKNTEIPIVLIGHSIGSYIAIEMFKRSLDKVKYCIGLYPFLALNPHSKKQLLIGKIAE*
• ORF Type: complete

Annotations of Ll_transcript_419158

• Blastp: Lipid droplet-associated hydrolase from Dictyostelium with 31.78% of identity
• Blastx: Lipid droplet-associated hydrolase from Dictyostelium with 31.78% of identity
• Eggnog: chromosome 2 open reading frame 43(ENOG410ZTV7)
• Kegg: Link to kegg annotations (DDB_G0286581)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456266.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;