Protein coding transcript 60811

• Transcript: Ll_transcript_419159
• CDS coordinates: 320-1252 (+)
• Peptide sequence: MSLETNLLAKAKRHAAFRLCDVSNYTSEILEIQADAPSLHVLFVPGNPGVIFFYKDFVEYLYELLGGTASVTAIGHVSQTKKNWEHGRLFSLHEQIDHKIDFIREELKNTEIPIVLIGHSIGSYIAIEMFKRSPEKVKYCIGLYPFLTLNPHSEKQIVIGKIAESRILSAALSYLIASLGLLPAWALRFIVRKSLGKSWSANAVEATCSHLSQYHTMRNVLYMAMTEFGEFSEAPDWTFIRERKAQFAFLFGDDDHWAPLQVLEEISEQVPGIVTAIERENHTHGFCCTEAGSLWVAQHVANLIKNQTYK*
• ORF Type: complete

Annotations of Ll_transcript_419159

• Blastp: Lipid droplet-associated hydrolase from Gallus with 28.09% of identity
• Blastx: Lipid droplet-associated hydrolase from Gallus with 26.37% of identity
• Eggnog: chromosome 2 open reading frame 43(ENOG410ZTV7)
• Kegg: Link to kegg annotations (421967)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456266.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;