Protein coding transcript 60817

• Transcript: Ll_transcript_419165
• CDS coordinates: 304-969 (+)
• Peptide sequence: MSLETNLLAKAKRHAAFRLCDVSNYTSEILEIQADAPSLHVLFVPGNPGVIFFYKDFVEYLYELLGGTASVTAIGHVSQTKKNWEHGRLFSLHEQIDHKIDFIREELKNTEIPIVLIGHSIGSYIAIEMFKRSPEKVKYCIGLYPFLTLNPHSEKQIVIGKIAESRILSAALSYLIASLGLLPAWALRFIVRKSLGKSWSANAVEATCSHLSQVSSIVGRD*
• ORF Type: complete

Annotations of Ll_transcript_419165

• Blastp: Lipid droplet-associated hydrolase from Rattus with 30.32% of identity
• Blastx: Lipid droplet-associated hydrolase from Dictyostelium with 32.56% of identity
• Eggnog: chromosome 2 open reading frame 43(ENOG410ZTV7)
• Kegg: Link to kegg annotations (313949)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456265.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;