| Transcript | Ll_transcript_419226 |
|---|---|
| CDS coordinates | 1-492 (+) |
| Peptide sequence | LCGGTTGAFRRSCDGQWVHAFCAEWVFESTFRRGQINAVEGVETLLKGTDICCICCCKHGVCMKCCYGHCRTTFHPYCARSVGLYMNVRTTGGKLQHKAYCQRHSLEQKEKAETQKHGIGEFKRMKQIRVRLPFPSFYPGVLSHFFVRLDVLLMALLYLLICD* |
| ORF Type | 5prime_partial |
| Blastp | NuA3 HAT complex component NTO1 from Saccharomyces with 35.14% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (YPR031W) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019416931.1) |
| Pfam | PHD-zinc-finger like domain (PF13832.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer