Protein coding transcript 60859

• Transcript: Ll_transcript_419232
• CDS coordinates: 1-822 (+)
• Peptide sequence: LCGGTTGAFRRSCDGQWVHAFCAEWVFESTFRRGQINAVEGVETLLKGTDICCICCCKHGVCMKCCYGHCRTTFHPYCARSVGLYMNVRTTGGKLQHKAYCQRHSLEQKEKAETQKHGIGEFKRMKQIRVELERLRLLCERIVKREKIKRELILCSHNMLAFKRDHVARSMLVHSPFILPDGSSESATTSLKGNTEGYRSCSEAVQQSDDVTVDSSISAKRHVRLAVSMDTDPKVDDDCSTSQSQYNQKIPERMQFSGKQIPRRASTTLLYHSD
• ORF Type: internal

Annotations of Ll_transcript_419232

• Blastp: NuA3 HAT complex component NTO1 from Saccharomyces with 35.14% of identity
• Blastx: Peregrin from Homo with 31.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YPR031W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416932.1)
• Pfam: PHD-zinc-finger like domain (PF13832.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;