Transcript | Ll_transcript_421320 |
---|---|
CDS coordinates | 424-858 (+) |
Peptide sequence | MSDDEDDQVDSDANLLDGGVDGHDSMGFGPLILTENERSLMERVRHELKHELKQGYKEKIVDIREEILRKRRAGKLPGGTTSVLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKNKRKR* |
ORF Type | complete |
Blastp | Homeobox protein knotted-1-like 3 from Arabidopsis with 89.51% of identity |
---|---|
Blastx | Homeobox protein knotted-1-like 3 from Malus with 93.63% of identity |
Eggnog | homeobox(ENOG410XPMQ) |
Kegg | Link to kegg annotations (AT5G25220) |
CantataDB | Link to cantataDB annotations (CNT0001697) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417140.1) |
Pfam | ELK domain (PF03789.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer