Protein coding transcript 60905

• Transcript: Ll_transcript_419722
• CDS coordinates: 1590-2330 (+)
• Peptide sequence: MVDGGTEGFKGHARVILPGITPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWNEVHGGIVFDPDNPEHMKWVYDEAVKRAELFGIPGVTYSFTQGVVKNIIPAIASTNAIISAACALETLKIATDCSKIMSNYLTYNGSEGLHTKVAEFERDKDCLVCGPGVLIELDPSITLQKFMDLLEEHPKLRLSKASITHRGKNLYMQAPPVLEEMTRSNLVLPLFDLMGKLSKDIIHVNGMTS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_419722

• Blastp: NEDD8-activating enzyme E1 catalytic subunit from Arabidopsis with 76.92% of identity
• Blastx: NEDD8-activating enzyme E1 catalytic subunit from Arabidopsis with 76.23% of identity
• Eggnog: small protein activating enzyme activity(COG0476)
• Kegg: Link to kegg annotations (AT5G19180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430388.1)
• Pfam: ThiF family (PF00899.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;