Transcript | Ll_transcript_419726 |
---|---|
CDS coordinates | 2-1111 (+) |
Peptide sequence | KRAEESGMGMAESEGSRWRDLDKLLLRRGNLVGSRFEPGPDLRDDLQTYATVLVVGAGGLGCELLKDLALSGFRNLHVIDMDRIEVTNLNRQFLFRVEDVGKPKAEVAAKRVMERISGLNIVPHFCRIEDKEIDFYNDFNIIALGLDSLEARSYINNVACSFLEYDSDDNPREETIKPMVDGGTEGFKGHARVILPGITPCFECTIWLFPPQVKFPLCTLAETPRTAAHCIEYAHLIKWNEVHGGIVFDPDNPEHMKWVYDEAVKRAELFGIPGVTYSFTQGVVKNIIPAIASTNAIISAACALETLKIATDCSKIMSNYLTYNGSEGLHTKVAEFERDKDCLVCGPGVLIELDPSITLQKVISGFLSS* |
ORF Type | 5prime_partial |
Blastp | NEDD8-activating enzyme E1 catalytic subunit from Arabidopsis with 82.18% of identity |
---|---|
Blastx | NEDD8-activating enzyme E1 catalytic subunit from Arabidopsis with 82.39% of identity |
Eggnog | small protein activating enzyme activity(COG0476) |
Kegg | Link to kegg annotations (AT5G19180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418855.1) |
Pfam | ThiF family (PF00899.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer