Transcript | Ll_transcript_420057 |
---|---|
CDS coordinates | 1004-1306 (+) |
Peptide sequence | MHHIFVCFVGTSGESIYGSDFSDESSRLKHDAPGLLSMAISDRDTLGSHFIITLKADHHLDRFVYLIYSWWPFIHYMFYFYRGVMKGTLLDCTVVGSECH* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase CYP95 from Arabidopsis with 50.74% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase CYP95 from Arabidopsis with 78.38% of identity |
Eggnog | peptidyl-prolyl cis-trans isomerase activity(COG0652) |
Kegg | Link to kegg annotations (AT4G32420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416706.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer