Transcript | Ll_transcript_420058 |
---|---|
CDS coordinates | 273-617 (+) |
Peptide sequence | MHHFTVVNGLLVCILTGARWFIFCRLVILPIKMLSELQALFHLHVPYDNGTSGESIYGSDFSDESSRLKHDAPGLLSMAISDRDTLGSHFIITLKADHHLDRKNVVFGKLVLGHN |
ORF Type | 3prime_partial |
Blastp | Peptidyl-prolyl cis-trans isomerase CYP95 from Arabidopsis with 61.54% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase CYP95 from Arabidopsis with 61.54% of identity |
Eggnog | peptidyl-prolyl cis-trans isomerase activity(COG0652) |
Kegg | Link to kegg annotations (AT4G32420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416704.1) |
Pfam | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer