Protein coding transcript 61050

• Transcript: Ll_transcript_420034
• CDS coordinates: 940-1242 (+)
• Peptide sequence: MHHIFVCFVGTSGESIYGSDFSDESSRLKHDAPGLLSMAISDRDTLGSHFIITLKADHHLDRFVYLIYSWWPFIHYMFYFYRGVMKGTLLDCTVVGSECH*
• ORF Type: complete

Annotations of Ll_transcript_420034

• Blastp: Peptidyl-prolyl cis-trans isomerase CYP95 from Arabidopsis with 49.08% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase CYP95 from Arabidopsis with 56.9% of identity
• Eggnog: peptidyl-prolyl cis-trans isomerase activity(COG0652)
• Kegg: Link to kegg annotations (AT4G32420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416706.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;