Protein coding transcript 6107

• Transcript: Ll_transcript_523893
• CDS coordinates: 198-944 (+)
• Peptide sequence: MASSKVGLATNPDQPRNSSSSSSSISSSSHHSLPTLFLNLSDSDHHRHPMDDLLNSIYPTAAAAAAAPPSKTADEVWKDIVAGNSSGTHQSNNNTNSEGLDVVTLEDYLIKERVLSVPSAAAAASGTTAMVQFGNGVDGTVVGTSGGGGGKGKRRVMEETVDKATLQKQRRMIKNRESAARSRERKQAYTSELEYLVHQLEQENARLLNETADEKRQRFKQLMECIIPIEERPRPPIRSFRRTNSSPM*
• ORF Type: complete

Annotations of Ll_transcript_523893

• Blastp: G-box-binding factor 4 from Arabidopsis with 37.05% of identity
• Blastx: G-box-binding factor 4 from Arabidopsis with 39.29% of identity
• Eggnog: Transcription factor(ENOG410ZKZR)
• Kegg: Link to kegg annotations (AT1G03970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441045.1)
• Pfam: bZIP transcription factor (PF00170.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;