Protein coding transcript 61218

• Transcript: Ll_transcript_419432
• CDS coordinates: 277-615 (+)
• Peptide sequence: MELDPSNIEGGGTEGCSSHQKTTGRGTIELKRIENTKNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYANNRDTTNKLLHNLYYKLLRFYGEDGGLKDGSA*
• ORF Type: complete

Annotations of Ll_transcript_419432

• Blastp: Agamous-like MADS-box protein AGL5 from Arabidopsis with 77.33% of identity
• Blastx: Agamous-like MADS-box protein AGL5 from Arabidopsis with 75.22% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G42830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461251.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;