Protein coding transcript 61242

• Transcript: Ll_transcript_421550
• CDS coordinates: 209-544 (+)
• Peptide sequence: MSLAQRMIRTFSLNMSTSSGQSWTAISDSPEDTVRITTRKITERGQPNGVILGAVSTIWLPYPHTKVFDLLRDERHRSQVVPINLTIHSMMNHVHLIIPQPNLLQLLTKSG*
• ORF Type: complete

Annotations of Ll_transcript_421550

• Blastp: Homeobox-leucine zipper protein HDG5 from Arabidopsis with 61.54% of identity
• Blastx: Homeobox-leucine zipper protein HDG5 from Arabidopsis with 60.44% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410YCQU)
• Kegg: Link to kegg annotations (AT5G46880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423571.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;