Transcript | Ll_transcript_421553 |
---|---|
CDS coordinates | 178-486 (+) |
Peptide sequence | MYGDCQVMSNMGGSVVVNSDSLFSSSIQNSNFKFMPTMPFQPFPPLKEEDGILVGIGKEEMESGSGSEQVEDKSGNEQEGEEPPKKKRYHRHTARQIQEMEA* |
ORF Type | complete |
Blastp | Homeobox-leucine zipper protein ROC2 from Oryza sativa with 57.45% of identity |
---|---|
Blastx | - |
Eggnog | Homeobox-leucine zipper protein(ENOG411107H) |
Kegg | Link to kegg annotations (4337074) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435331.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer