Protein coding transcript 613

• Transcript: Ll_transcript_523272
• CDS coordinates: 42-485 (+)
• Peptide sequence: MAEQDETVKKKRLFRKFTFQGVDLDQLLDLPGEQLTQLMHCRARRRFVRGLRRKPMALVKKLRKAKKETPPNEKPEVVKTHLRNMIVMPEMVGSMVGVYNGKTFAQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK*
• ORF Type: complete

Annotations of Ll_transcript_523272

• Blastp: 40S ribosomal protein S15 from Elaeis with 78.26% of identity
• Blastx: 40S ribosomal protein S15 from Rattus with 80.27% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014512370.1)
• Pfam: Ribosomal protein S19 (PF00203.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;